Protein Info for b0970 in Escherichia coli BW25113

Name: yccA
Annotation: inner membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 45 to 45 (1 residues), see Phobius details amino acids 49 to 67 (19 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details amino acids 105 to 125 (21 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details PF01027: Bax1-I" amino acids 18 to 216 (199 residues), 187.2 bits, see alignment E=1.7e-59

Best Hits

Swiss-Prot: 100% identical to YCCA_ECOL6: Inner membrane protein YccA (yccA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K06890, (no description) (inferred from 100% identity to eco:b0970)

Predicted SEED Role

"Putative TEGT family carrier/transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AAC6 at UniProt or InterPro

Protein Sequence (219 amino acids)

>b0970 inner membrane protein (NCBI) (Escherichia coli BW25113)
MDRIVSSSHDRTSLLSTHKVLRNTYFLLSLTLAFSAITATASTVLMLPSPGLILTLVGMY
GLMFLTYKTANKPTGIISAFAFTGFLGYILGPILNTYLSAGMGDVIAMALGGTALVFFCC
SAYVLTTRKDMSFLGGMLMAGIVVVLIGMVANIFLQLPALHLAISAVFILISSGAILFET
SNIIHGGETNYIRATVSLYVSLYNIFVSLLSILGFASRD