Protein Info for b0968 in Escherichia coli BW25113

Name: yccX
Annotation: predicted acylphosphatase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to ACYP_ECOLI: Acylphosphatase (yccX) from Escherichia coli (strain K12)

KEGG orthology group: K01512, acylphosphatase [EC: 3.6.1.7] (inferred from 100% identity to eco:b0968)

MetaCyc: 100% identical to acylphosphatase (Escherichia coli K-12 substr. MG1655)
Acylphosphatase. [EC: 3.6.1.7]

Predicted SEED Role

"Acylphosphate phosphohydrolase (EC 3.6.1.7), putative" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 3.6.1.7)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AB65 at UniProt or InterPro

Protein Sequence (92 amino acids)

>b0968 predicted acylphosphatase (NCBI) (Escherichia coli BW25113)
MSKVCIIAWVYGRVQGVGFRYTTQYEAKRLGLTGYAKNLDDGSVEVVACGEEGQVEKLMQ
WLKSGGPRSARVERVLSEPHHPSGELTDFRIR