Protein Info for b0967 in Escherichia coli BW25113

Name: yccW
Annotation: predicted methyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF17785: PUA_3
  • amino acids 6 to 68 (63 residues), 70.6 bits, E=2.8e-23
• PF10672: Methyltrans_SAM
  • amino acids 112 to 357 (246 residues), 102.3 bits, E=1e-32
• PF03602: Cons_hypoth95
  • amino acids 217 to 302 (86 residues), 46.5 bits, E=1.3e-15
• PF13847: Methyltransf_31
  • amino acids 221 to 352 (132 residues), 38.4 bits, E=3.4e-13
• PF05175: MTS
  • amino acids 244 to 351 (108 residues), 25.9 bits, E=2.5e-09

Best Hits

Swiss-Prot: 100% identical to RLMI_ECOLC: Ribosomal RNA large subunit methyltransferase I (rlmI) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

KEGG orthology group: K06969, ribosomal RNA large subunit methyltransferase I [EC: 2.1.1.-] (inferred from 100% identity to eco:b0967)

MetaCyc: 100% identical to 23S rRNA m5C1962 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11602 [EC: 2.1.1.191]

Predicted SEED Role

"LSU m5C1962 methyltransferase RlmI" in subsystem Ribosome biogenesis bacterial

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.191

Sequence Analysis Tools

See P75876 at UniProt or InterPro

Protein Sequence (396 amino acids)

>b0967 predicted methyltransferase (RefSeq) (Escherichia coli BW25113)
MSVRLVLAKGREKSLLRRHPWVFSGAVARMEGKASLGETIDIVDHQGKWLARGAYSPASQ
IRARVWTFDPSESIDIAFFSRRLQQAQKWRDWLAQKDGLDSYRLIAGESDGLPGITIDRF
GNFLVLQLLSAGAEYQRAALISALQTLYPECSIYDRSDVAVRKKEGMELTQGPVTGELPP
ALLPIEEHGMKLLVDIQHGHKTGYYLDQRDSRLATRRYVENKRVLNCFSYTGGFAVSALM
GGCSQVVSVDTSQEALDIARQNVELNKLDLSKAEFVRDDVFKLLRTYRDRGEKFDVIVMD
PPKFVENKSQLMGACRGYKDINMLAIQLLNEGGILLTFSCSGLMTSDLFQKIIADAAIDA
GRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM