Protein Info for b0966 in Escherichia coli BW25113

Name: hspQ
Annotation: DNA-binding protein, hemimethylated (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 TIGR02097: hemimethylated DNA binding domain" amino acids 4 to 102 (99 residues), 118.2 bits, see alignment E=8.4e-39 PF08755: YccV-like" amino acids 5 to 96 (92 residues), 75.4 bits, see alignment E=1.9e-25

Best Hits

Swiss-Prot: 100% identical to HSPQ_ECO81: Heat shock protein HspQ (hspQ) from Escherichia coli O81 (strain ED1a)

KEGG orthology group: K11940, heat shock protein HspQ (inferred from 100% identity to eco:b0966)

Predicted SEED Role

"hemimethylated DNA binding protein YccV"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AB20 at UniProt or InterPro

Protein Sequence (105 amino acids)

>b0966 DNA-binding protein, hemimethylated (RefSeq) (Escherichia coli BW25113)
MIASKFGIGQQVRHSLLGYLGVVVDIDPVYSLSEPSPDELAVNDELRAAPWYHVVMEDDN
GLPVHTYLAEAQLSSELQDEHPEQPSMDELAQTIRKQLQAPRLRN