Protein Info for b0957 in Escherichia coli BW25113

Name: ompA
Annotation: outer membrane protein A (3a;II*;G;d) (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13505: OMP_b-brl" amino acids 8 to 191 (184 residues), 77.7 bits, see alignment E=1.9e-25 PF01389: OmpA_membrane" amino acids 23 to 195 (173 residues), 265.1 bits, see alignment E=4.6e-83 PF00691: OmpA" amino acids 222 to 317 (96 residues), 84.5 bits, see alignment E=9e-28

Best Hits

Swiss-Prot: 100% identical to OMPA_ECO57: Outer membrane protein A (ompA) from Escherichia coli O157:H7

KEGG orthology group: K03286, OmpA-OmpF porin, OOP family (inferred from 100% identity to eco:b0957)

Predicted SEED Role

"Outer membrane protein A precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A910 at UniProt or InterPro

Protein Sequence (346 amino acids)

>b0957 outer membrane protein A (3a;II*;G;d) (NCBI) (Escherichia coli BW25113)
MKKTAIAIAVALAGFATVAQAAPKDNTWYTGAKLGWSQYHDTGFINNNGPTHENQLGAGA
FGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGG
MVWRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWTNNIGDAHTIGTRPDN
GMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQ
LYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGM
GESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA