Protein Info for b0951 in Escherichia coli BW25113

Name: pqiB
Annotation: paraquat-inducible protein B (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 546 transmembrane" amino acids 19 to 38 (20 residues), see Phobius details PF02470: MlaD" amino acids 42 to 133 (92 residues), 47 bits, see alignment E=1.2e-16 amino acids 157 to 233 (77 residues), 37.4 bits, see alignment E=1.2e-13 amino acids 288 to 388 (101 residues), 39.4 bits, see alignment E=3e-14

Best Hits

Swiss-Prot: 100% identical to PQIB_ECOLI: Intermembrane transport protein PqiB (pqiB) from Escherichia coli (strain K12)

KEGG orthology group: K06192, paraquat-inducible protein B (inferred from 100% identity to eco:b0951)

Predicted SEED Role

"Paraquat-inducible protein B" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P43671 at UniProt or InterPro

Protein Sequence (546 amino acids)

>b0951 paraquat-inducible protein B (NCBI) (Escherichia coli BW25113)
MESNNGEAKIQKVKNWSPVWIFPIVTALIGAWVLFYHYSHQGPEVTLITANAEGIEGGKT
TIKSRSVDVGVVESATLADDLTHVEIKARLNSGMEKLLHKDTVFWVVKPQIGREGISGLG
TLLSGVYIELQPGAKGSKMDKYDLLDSPPLAPPDAKGIRVILDSKKAGQLSPGDPVLFRG
YRVGSVETSTFDTQKRNISYQLFINAPYDRLVTNNVRFWKDSGIAVDLTSAGMRVEMGSL
TTLLSGGVSFDVPEGLDLGQPVAPKTAFVLYDDQKSIQDSLYTDHIDYLMFFKDSVRGLQ
PGAPVEFRGIRLGTVSKVPFFAPNMRQTFNDDYRIPVLIRIEPERLKMQLGENADVVEHL
GELLKRGLRGSLKTGNLVTGALYVDLDFYPNTPAITGIREFNGYQIIPTVSGGLAQIQQR
LMEALDKINKLPLNPMIEQATSTLSESQRTMKNLQTTLDSMNKILASQSMQQLPTDMQST
LRELNRSMQGFQPGSAAYNKMVADMQRLDQVLRELQPVLKTLNEKSNALVFEAKDKKDPE
PKRAKQ