Protein Info for b0931 in Escherichia coli BW25113

Name: pncB
Annotation: nicotinate phosphoribosyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 TIGR01514: nicotinate phosphoribosyltransferase" amino acids 8 to 394 (387 residues), 621.2 bits, see alignment E=4.1e-191 PF17767: NAPRTase_N" amino acids 13 to 130 (118 residues), 128 bits, see alignment E=2.8e-41 PF04095: NAPRTase" amino acids 169 to 395 (227 residues), 314.4 bits, see alignment E=6e-98

Best Hits

Swiss-Prot: 100% identical to PNCB_ECOLI: Nicotinate phosphoribosyltransferase (pncB) from Escherichia coli (strain K12)

KEGG orthology group: K00763, nicotinate phosphoribosyltransferase [EC: 2.4.2.11] (inferred from 100% identity to eco:b0931)

MetaCyc: 100% identical to nicotinate phosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
NICOTINATEPRIBOSYLTRANS-RXN [EC: 6.3.4.21]

Predicted SEED Role

"Nicotinate phosphoribosyltransferase (EC 2.4.2.11)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or Redox-dependent regulation of nucleus processes (EC 2.4.2.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.11 or 6.3.4.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P18133 at UniProt or InterPro

Protein Sequence (400 amino acids)

>b0931 nicotinate phosphoribosyltransferase (NCBI) (Escherichia coli BW25113)
MTQFASPVLHSLLDTDAYKLHMQQAVFHHYYDVHVAAEFRCRGDDLLGIYADAIREQVQA
MQHLRLQDDEYQWLSALPFFKADYLNWLREFRFNPEQVTVSNDNGKLDIRLSGPWREVIL
WEVPLLAVISEMVHRYRSPQADVAQALDTLESKLVDFSALTAGLDMSRFHLMDFGTRRRF
SREVQETIVKRLQQESWFVGTSNYDLARRLSLTPMGTQAHEWFQAHQQISPDLANSQRAA
LAAWLEEYPDQLGIALTDCITMDAFLRDFGVEFASRYQGLRHDSGDPVEWGEKAIAHYEK
LGIDPQSKTLVFSDNLDLRKAVELYRHFSSRVQLSFGIGTRLTCDIPQVKPLNIVIKLVE
CNGKPVAKLSDSPGKTICHDKAFVRALRKAFDLPHIKKAS