Protein Info for b0922 in Escherichia coli BW25113

Name: mukF
Annotation: condesin subunit F (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 PF03882: WHD_KicB" amino acids 3 to 117 (115 residues), 193 bits, see alignment E=2.1e-61 PF17192: MukF_M" amino acids 121 to 281 (161 residues), 284 bits, see alignment E=4.9e-89 PF17193: MukF_C" amino acids 283 to 440 (158 residues), 269.9 bits, see alignment E=1.3e-84

Best Hits

Swiss-Prot: 100% identical to MUKF_ECO8A: Chromosome partition protein MukF (mukF) from Escherichia coli O8 (strain IAI1)

KEGG orthology group: K03633, chromosome partition protein MukF (inferred from 100% identity to eco:b0922)

Predicted SEED Role

"Chromosome partition protein MukF" in subsystem DNA structural proteins, bacterial or MukBEF Chromosome Condensation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P60293 at UniProt or InterPro

Protein Sequence (440 amino acids)

>b0922 condesin subunit F (NCBI) (Escherichia coli BW25113)
MSEFSQTVPELVAWARKNDFSISLPVDRLSFLLAVATLNGERLDGEMSEGELVDAFRHVS
DAFEQTSETIGVRANNAINDMVRQRLLNRFTSEQAEGNAIYRLTPLGIGITDYYIRQREF
STLRLSMQLSIVAGELKRAADAAEEGGDEFHWHRNVYAPLKYSVAEIFDSIDLTQRLMDE
QQQQVKDDIAQLLNKDWRAAISSCELLLSETSGTLRELQDTLEAAGDKLQANLLRIQDAT
MTHDDLHFVDRLVFDLQSKLDRIISWGQQSIDLWIGYDRHVHKFIRTAIDMDKNRVFAQR
LRQSVQTYFDEPWALTYANADRLLDMRDEEMALRDEEVTGELPEDLEYEEFNEIREQLAA
IIEEQLAVYKTRQVPLDLGLVVREYLSQYPRARHFDVARIVIDQAVRLGVAQADFTGLPA
KWQPINDYGAKVQAHVIDKY