Protein Info for b0914 in Escherichia coli BW25113

Name: msbA
Annotation: fused lipid transporter subunits of ABC superfamily: membrane component/ATP-binding component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 582 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 65 to 93 (29 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 246 to 270 (25 residues), see Phobius details amino acids 277 to 295 (19 residues), see Phobius details TIGR02203: lipid A export permease/ATP-binding protein MsbA" amino acids 12 to 581 (570 residues), 913.6 bits, see alignment E=2.3e-279 PF00664: ABC_membrane" amino acids 27 to 298 (272 residues), 215.3 bits, see alignment E=1.4e-67 PF00005: ABC_tran" amino acids 359 to 509 (151 residues), 122.8 bits, see alignment E=1.6e-39

Best Hits

Swiss-Prot: 100% identical to MSBA_SHIBS: Lipid A export ATP-binding/permease protein MsbA (msbA) from Shigella boydii serotype 4 (strain Sb227)

KEGG orthology group: K11085, ATP-binding cassette, subfamily B, bacterial MsbA [EC: 3.6.3.-] (inferred from 100% identity to eco:b0914)

MetaCyc: 100% identical to ATP-binding lipopolysaccharide transport protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-236 [EC: 7.5.2.6]; 7.5.2.6 [EC: 7.5.2.6]

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.5.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P60752 at UniProt or InterPro

Protein Sequence (582 amino acids)

>b0914 fused lipid transporter subunits of ABC superfamily: membrane component/ATP-binding component (NCBI) (Escherichia coli BW25113)
MHNDKDLSTWQTFRRLWPTIAPFKAGLIVAGVALILNAASDTFMLSLLKPLLDDGFGKTD
RSVLVWMPLVVIGLMILRGITSYVSSYCISWVSGKVVMTMRRRLFGHMMGMPVSFFDKQS
TGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILIVLAPIVSI
AIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNRMRLQ
GMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKS
LTNVNAQFQRGMAACQTLFTILDSEQEKDEGKRVIERATGDVEFRNVTFTYPGRDVPALR
NINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGEILMDGHDLREYTLASLRNQVA
LVSQNVHLFNDTVANNIAYARTEQYSREQIEEAARMAYAMDFINKMDNGLDTVIGENGVL
LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS
TIEKADEIVVVEDGVIVERGTHNDLLEHRGVYAQLHKMQFGQ