Protein Info for b0913 in Escherichia coli BW25113

Name: ycaI
Annotation: orf, hypothetical protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 754 transmembrane" amino acids 23 to 42 (20 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details amino acids 255 to 274 (20 residues), see Phobius details amino acids 301 to 321 (21 residues), see Phobius details amino acids 327 to 344 (18 residues), see Phobius details amino acids 357 to 381 (25 residues), see Phobius details amino acids 389 to 413 (25 residues), see Phobius details amino acids 422 to 439 (18 residues), see Phobius details amino acids 446 to 467 (22 residues), see Phobius details amino acids 473 to 491 (19 residues), see Phobius details TIGR00361: DNA internalization-related competence protein ComEC/Rec2" amino acids 65 to 718 (654 residues), 1128.7 bits, see alignment E=0 PF03772: Competence" amino acids 201 to 467 (267 residues), 181.1 bits, see alignment E=2.9e-57 TIGR00360: ComEC/Rec2-related protein" amino acids 221 to 405 (185 residues), 211 bits, see alignment E=1.5e-66 PF00753: Lactamase_B" amino acids 505 to 686 (182 residues), 83 bits, see alignment E=2.9e-27

Best Hits

Swiss-Prot: 100% identical to YCAI_ECOLI: Uncharacterized protein YcaI (ycaI) from Escherichia coli (strain K12)

KEGG orthology group: K02238, competence protein ComEC (inferred from 100% identity to eco:b0913)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P37443 at UniProt or InterPro

Protein Sequence (754 amino acids)

>b0913 orf, hypothetical protein (VIMSS) (Escherichia coli BW25113)
MKITTVGVCIISGIFPLLILPQLPGTLTLAFLTLFACVLAFIPVKTVRYIALTLLFFVWG
ILSAKQILWAGETLTGATQDAIVEITATDGMTTHYGQITHLQGRRIFPASGLVMYGEYLP
QAVCAGQQWSMKLKVRAVHGQLNDGGFDSQRYAIAQHQPLTGRFLQASVIEPNCSLRAQY
LASLQTTLQPYPWNAVILGLGMGERLSVPKEIKNIMRDTGTAHLMAISGLHIAFAALLAA
GLIRSGQIFLPGRWIHWQIPLIGGICCAAFYAWLTGMQPPALRTMVALATWGMLKLSGRQ
WSGWDVWICCLAAILLMDPVAILSQSLWLSAAAVAALIFWYQWFPCPEWQLPPVLRAVVS
LIHLQLGITLLLMPVQIVIFHGISLTSFIANLLAIPLVTFITVPLILAAMVVHLSGPLIL
EQGLWFLADRSLALLFWGLKSLPEGWINIAECWQWLSFSPWFLLVVWRLNAWRTLPAMCV
AGGLLMCWPLWQKPRPDEWQLYMLDVGQGLAMVIARNGKAILYDTGLAWPEGDSGQQLII
PWLHWHNLEPEGVILSHEHLDHRGGLDSILHIWPMLWIRSPLNWEHHQPCVRGEAWQWQG
LRFSAHWPLQGSNDKGNNHSCVVKVDDGTNSILLTGDIEAPAEQKMLSRYWQQVQATLLQ
VPHHGSNTSSSLPLIQRVNGKVALASASRYNAWRLPSNKVKHRYQLQGYQWIDTPHQGQT
TVNFSAQGWRISSLREQILPRWYHQWFGVPVDNG