Protein Info for b0902 in Escherichia coli BW25113

Name: pflA
Annotation: pyruvate formate lyase activating enzyme 1 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02493: pyruvate formate-lyase 1-activating enzyme
  • amino acids 6 to 239 (234 residues), 357.9 bits, E=2.1e-111
• PF13353: Fer4_12
  • amino acids 16 to 148 (133 residues), 63.3 bits, E=3.2e-21
• PF04055: Radical_SAM
  • amino acids 24 to 178 (155 residues), 97.8 bits, E=8.4e-32

Best Hits

Swiss-Prot: 100% identical to PFLA_SHIFL: Pyruvate formate-lyase 1-activating enzyme (pflA) from Shigella flexneri

KEGG orthology group: K04069, pyruvate formate lyase activating enzyme [EC: 1.97.1.4] (inferred from 100% identity to eco:b0902)

Predicted SEED Role

"Pyruvate formate-lyase activating enzyme (EC 1.97.1.4)" in subsystem Fermentations: Mixed acid or Threonine anaerobic catabolism gene cluster (EC 1.97.1.4)

MetaCyc Pathways

• superpathway of N-acetylneuraminate degradation (22/22 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (19/19 steps found)
• mixed acid fermentation (16/16 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (8/9 steps found)
• pyruvate fermentation to acetate IV (3/3 steps found)
• pyruvate fermentation to ethanol I (3/3 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (10/13 steps found)
• reductive monocarboxylic acid cycle (2/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.97.1.4

Use Curated BLAST to search for 1.97.1.4

Sequence Analysis Tools

See P0A9N4 at UniProt or InterPro

Protein Sequence (246 amino acids)

>b0902 pyruvate formate lyase activating enzyme 1 (NCBI) (Escherichia coli BW25113)
MSVIGRIHSFESCGTVDGPGIRFITFFQGCLMRCLYCHNRDTWDTHGGKEVTVEDLMKEV
VTYRHFMNASGGGVTASGGEAILQAEFVRDWFRACKKEGIHTCLDTNGFVRRYDPVIDEL
LEVTDLVMLDLKQMNDEIHQNLVGVSNHRTLEFAKYLANKNVKVWIRYVVVPGWSDDDDS
AHRLGEFTRDMGNVEKIELLPYHELGKHKWVAMGEEYKLDGVKPPKKETMERVKGILEQY
GHKVMF