Protein Info for b0899 in Escherichia coli BW25113

Name: b0899
Annotation: putative transport (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 38 to 60 (23 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 126 to 146 (21 residues), see Phobius details amino acids 156 to 179 (24 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 239 to 261 (23 residues), see Phobius details amino acids 292 to 312 (21 residues), see Phobius details amino acids 344 to 363 (20 residues), see Phobius details amino acids 383 to 400 (18 residues), see Phobius details amino acids 414 to 435 (22 residues), see Phobius details amino acids 447 to 470 (24 residues), see Phobius details PF13520: AA_permease_2" amino acids 11 to 441 (431 residues), 99.5 bits, see alignment E=2.2e-32 PF00324: AA_permease" amino acids 27 to 439 (413 residues), 54.7 bits, see alignment E=7.4e-19

Best Hits

Swiss-Prot: 100% identical to YCAM_ECOLI: Inner membrane transporter YcaM (ycaM) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b0899)

Predicted SEED Role

"Probable transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P75835 at UniProt or InterPro

Protein Sequence (476 amino acids)

>b0899 putative transport (VIMSS) (Escherichia coli BW25113)
MAGNVQEKQLRWYNIALMSFITVWGFGNVVNNYANQGLVVVFSWVFIFALYFTPYALIVG
QLGSTFKDGKGGVSTWIKHTMGPGLAYLAAWTYWVVHIPYLAQKPQAILIALGWAMKGDG
SLIKEYSVVALQGLTLVLFIFFMWVASRGMKSLKIVGSVAGIAMFVMSLLYVAMAVTAPA
ITEVHIATTNITWETFIPHIDFTYITTISMLVFAVGGAEKISPYVNQTRNPGKEFPKGML
CLAVMVAVCAILGSLAMGMMFDSRNIPDDLMTNGQYYAFQKLGEYYNMGNTLMVIYAIAN
TLGQVAALVFSIDAPLKVLLGDADSKYIPASLCRTNASGTPVNGYFLTLVLVAILIMLPT
LGIGDMNNLYKWLLNLNSVVMPLRYLWVFVAFIAVVRLAQKYKPEYVFIRNKPLAMTVGI
WCFAFTAFACLTGIFPKMEAFTAEWTFQLALNVATPFVLVGLGLIFPLLARKANSK