Protein Info for b0895 in Escherichia coli BW25113

Name: dmsB
Annotation: dimethyl sulfoxide reductase, anaerobic, subunit B (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02951: dimethylsulfoxide reductase, chain B
  • amino acids 4 to 163 (160 residues), 268.1 bits, E=1.4e-84
• PF12797: Fer4_2
  • amino acids 7 to 25 (19 residues), 25.1 bits, see alignment (E = 4.3e-09)
  • amino acids 91 to 111 (21 residues), 26.4 bits, see alignment (E = 1.6e-09)
• PF13247: Fer4_11
  • amino acids 59 to 153 (95 residues), 103.1 bits, E=2.8e-33
• PF12838: Fer4_7
  • amino acids 67 to 113 (47 residues), 28.2 bits, 7.5e-10
• PF12837: Fer4_6
  • amino acids 91 to 114 (24 residues), 32.1 bits, see alignment (E = 2.6e-11)
• PF00037: Fer4
  • amino acids 92 to 114 (23 residues), 30.9 bits, see alignment (E = 5.9e-11)

Best Hits

Swiss-Prot: 100% identical to DMSB_ECOLI: Anaerobic dimethyl sulfoxide reductase chain B (dmsB) from Escherichia coli (strain K12)

KEGG orthology group: K07307, anaerobic dimethyl sulfoxide reductase subunit B (DMSO reductase iron- sulfur subunit) (inferred from 100% identity to eco:b0895)

MetaCyc: 100% identical to dimethyl sulfoxide reductase subunit B (Escherichia coli K-12 substr. MG1655)
DIMESULFREDUCT-RXN [EC: 1.8.5.3]

Predicted SEED Role

No annotation

MetaCyc Pathways

• NADH to dimethyl sulfoxide electron transfer (2/2 steps found)
• formate to dimethyl sulfoxide electron transfer (2/2 steps found)
• hydrogen to dimethyl sulfoxide electron transfer (1/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.8.5.3

Use Curated BLAST to search for 1.8.5.3

Sequence Analysis Tools

See P18776 at UniProt or InterPro

Protein Sequence (205 amino acids)

>b0895 dimethyl sulfoxide reductase, anaerobic, subunit B (NCBI) (Escherichia coli BW25113)
MTTQYGFFIDSSRCTGCKTCELACKDYKDLTPEVSFRRIYEYAGGDWQEDNGVWHQNVFA
YYLSISCNHCEDPACTKVCPSGAMHKREDGFVVVDEDVCIGCRYCHMACPYGAPQYNETK
GHMTKCDGCYDRVAEGKKPICVESCPLRALDFGPIDELRKKHGDLAAVAPLPRAHFTKPN
IVIKPNANSRPTGDTTGYLANPKEV