Protein Info for b0884 in Escherichia coli BW25113

Name: infA
Annotation: translation initiation factor IF-1 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 72 TIGR00008: translation initiation factor IF-1" amino acids 3 to 71 (69 residues), 130.1 bits, see alignment E=1.1e-42 PF01176: eIF-1a" amino acids 7 to 70 (64 residues), 99.6 bits, see alignment E=3e-33

Best Hits

Swiss-Prot: 100% identical to IF1_SALCH: Translation initiation factor IF-1 (infA) from Salmonella choleraesuis (strain SC-B67)

KEGG orthology group: K02518, translation initiation factor IF-1 (inferred from 100% identity to eco:b0884)

Predicted SEED Role

"Translation initiation factor 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P69222 at UniProt or InterPro

Protein Sequence (72 amino acids)

>b0884 translation initiation factor IF-1 (NCBI) (Escherichia coli BW25113)
MAKEDNIEMQGTVLETLPNTMFRVELENGHVVTAHISGKMRKNYIRILTGDKVTVELTPY
DLSKGRIVFRSR