Protein Info for b0882 in Escherichia coli BW25113

Name: clpA
Annotation: ATPase and specificity subunit of ClpA-ClpP ATP-dependent serine protease, chaperone activity (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 758 TIGR02639: ATP-dependent Clp protease ATP-binding subunit ClpA" amino acids 3 to 734 (732 residues), 1096.2 bits, see alignment E=0 PF02861: Clp_N" amino acids 13 to 62 (50 residues), 54.7 bits, see alignment 5.5e-18 PF00158: Sigma54_activat" amino acids 190 to 290 (101 residues), 20.9 bits, see alignment E=1.5e-07 PF05621: TniB" amino acids 193 to 346 (154 residues), 31.1 bits, see alignment E=9.6e-11 PF00004: AAA" amino acids 211 to 343 (133 residues), 51.6 bits, see alignment E=8e-17 amino acids 492 to 607 (116 residues), 36.4 bits, see alignment E=4e-12 PF17871: AAA_lid_9" amino acids 350 to 452 (103 residues), 99.5 bits, see alignment E=5.9e-32 PF07724: AAA_2" amino acids 486 to 647 (162 residues), 198.9 bits, see alignment E=3.7e-62 PF07728: AAA_5" amino acids 491 to 609 (119 residues), 50.4 bits, see alignment E=1.4e-16 PF10431: ClpB_D2-small" amino acids 653 to 733 (81 residues), 92.3 bits, see alignment E=9.5e-30

Best Hits

Swiss-Prot: 100% identical to CLPA_ECO57: ATP-dependent Clp protease ATP-binding subunit ClpA (clpA) from Escherichia coli O157:H7

KEGG orthology group: K03694, ATP-dependent Clp protease ATP-binding subunit ClpA (inferred from 100% identity to eck:EC55989_0927)

MetaCyc: 100% identical to ATP-dependent Clp protease ATP-binding subunit ClpA (Escherichia coli K-12 substr. MG1655)
Endopeptidase Clp. [EC: 3.4.21.92]

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpA" in subsystem Proteolysis in bacteria, ATP-dependent

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.92

Use Curated BLAST to search for 3.4.21.92

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0ABH9 at UniProt or InterPro

Protein Sequence (758 amino acids)

>b0882 ATPase and specificity subunit of ClpA-ClpP ATP-dependent serine protease, chaperone activity (NCBI) (Escherichia coli BW25113)
MLNQELELSLNMAFARAREHRHEFMTVEHLLLALLSNPSAREALEACSVDLVALRQELEA
FIEQTTPVLPASEEERDTQPTLSFQRVLQRAVFHVQSSGRNEVTGANVLVAIFSEQESQA
AYLLRKHEVSRLDVVNFISHGTRKDEPTQSSDPGSQPNSEEQAGGEERMENFTTNLNQLA
RVGGIDPLIGREKELERAIQVLCRRRKNNPLLVGESGVGKTAIAEGLAWRIVQGDVPEVM
ADCTIYSLDIGSLLAGTKYRGDFEKRFKALLKQLEQDTNSILFIDEIHTIIGAGAASGGQ
VDAANLIKPLLSSGKIRVIGSTTYQEFSNIFEKDRALARRFQKIDITEPSIEETVQIING
LKPKYEAHHDVRYTAKAVRAAVELAVKYINDRHLPDKAIDVIDEAGARARLMPVSKRKKT
VNVADIESVVARIARIPEKSVSQSDRDTLKNLGDRLKMLVFGQDKAIEALTEAIKMARAG
LGHEHKPVGSFLFAGPTGVGKTEVTVQLSKALGIELLRFDMSEYMERHTVSRLIGAPPGY
VGFDQGGLLTDAVIKHPHAVLLLDEIEKAHPDVFNILLQVMDNGTLTDNNGRKADFRNVV
LVMTTNAGVRETERKSIGLIHQDNSTDAMEEIKKIFTPEFRNRLDNIIWFDHLSTDVIHQ
VVDKFIVELQVQLDQKGVSLEVSQEARNWLAEKGYDRAMGARPMARVIQDNLKKPLANEL
LFGSLVDGGQVTVALDKEKNELTYGFQSAQKHKAEAAH