Protein Info for b0879 in Escherichia coli BW25113

Name: macB
Annotation: fused macrolide transporter subunits of ABC superfamily: ATP-binding component/membrane component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 648 transmembrane" amino acids 273 to 293 (21 residues), see Phobius details amino acids 523 to 548 (26 residues), see Phobius details amino acids 572 to 601 (30 residues), see Phobius details amino acids 608 to 631 (24 residues), see Phobius details PF00005: ABC_tran" amino acids 24 to 172 (149 residues), 116.5 bits, see alignment E=2.2e-37 PF12704: MacB_PCD" amino acids 272 to 491 (220 residues), 160.6 bits, see alignment E=1e-50 PF02687: FtsX" amino acids 527 to 641 (115 residues), 68.7 bits, see alignment E=7.2e-23

Best Hits

Swiss-Prot: 100% identical to MACB_ECOLI: Macrolide export ATP-binding/permease protein MacB (macB) from Escherichia coli (strain K12)

KEGG orthology group: K05685, macrolide transport system ATP-binding/permease protein [EC: 3.6.3.-] (inferred from 100% identity to eco:b0879)

MetaCyc: 100% identical to ABC-type tripartite efflux pump ATP binding/membrane subunit (Escherichia coli K-12 substr. MG1655)
7.6.2.-; 7.6.2.-; 7.6.2.-

Predicted SEED Role

"Macrolide export ATP-binding/permease protein MacB (EC 3.6.3.-)" in subsystem Multidrug Resistance Efflux Pumps (EC 3.6.3.-)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P75831 at UniProt or InterPro

Protein Sequence (648 amino acids)

>b0879 fused macrolide transporter subunits of ABC superfamily: ATP-binding component/membrane component (NCBI) (Escherichia coli BW25113)
MTPLLELKDIRRSYPAGDEQVEVLKGISLDIYAGEMVAIVGASGSGKSTLMNILGCLDKA
TSGTYRVAGQDVATLDADALAQLRREHFGFIFQRYHLLSHLTAEQNVEVPAVYAGLERKQ
RLLRAQELLQRLGLEDRTEYYPAQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG
EEVMAILHQLRDRGHTVIIVTHDPQVAAQAERVIEIRDGEIVRNPPAIEKVNVTGGTEPV
VNTVSGWRQFVSGFNEALTMAWRALAANKMRTLLTMLGIIIGIASVVSIVVVGDAAKQMV
LADIRSIGTNTIDVYPGKDFGDDDPQYQQALKYDDLIAIQKQPWVASATPAVSQNLRLRY
NNVDVAASANGVSGDYFNVYGMTFSEGNTFNQEQLNGRAQVVVLDSNTRRQLFPHKADVV
GEVILVGNMPARVIGVAEEKQSMFGSSKVLRVWLPYSTMSGRVMGQSWLNSITVRVKEGF
DSAEAEQQLTRLLSLRHGKKDFFTWNMDGVLKTVEKTTRTLQLFLTLVAVISLVVGGIGV
MNIMLVSVTERTREIGIRMAVGARASDVLQQFLIEAVLVCLVGGALGITLSLLIAFTLQL
FLPGWEIGFSPLALLLAFLCSTVTGILFGWLPARNAARLDPVDALARE