Protein Info for b0878 in Escherichia coli BW25113

Name: b0878
Annotation: putative membrane protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 40 to 362 (323 residues), 191.8 bits, see alignment E=7.6e-61 PF25917: BSH_RND" amino acids 60 to 216 (157 residues), 83.3 bits, see alignment E=2.7e-27 PF25973: BSH_CzcB" amino acids 62 to 210 (149 residues), 30.5 bits, see alignment E=8.3e-11 PF25876: HH_MFP_RND" amino acids 107 to 184 (78 residues), 81.7 bits, see alignment E=1.1e-26 PF25944: Beta-barrel_RND" amino acids 223 to 301 (79 residues), 91.5 bits, see alignment E=1.1e-29 PF25954: Beta-barrel_RND_2" amino acids 225 to 299 (75 residues), 34 bits, see alignment E=8.1e-12 PF25967: RND-MFP_C" amino acids 305 to 366 (62 residues), 79.8 bits, see alignment E=3.6e-26

Best Hits

Swiss-Prot: 100% identical to MACA_ECOLI: Macrolide export protein MacA (macA) from Escherichia coli (strain K12)

KEGG orthology group: K13888, macrolide-specific efflux protein MacA (inferred from 100% identity to eco:b0878)

MetaCyc: 100% identical to ABC-type tripartite efflux pump membrane fusion protein (Escherichia coli K-12 substr. MG1655)
7.6.2.-; 7.6.2.-; 7.6.2.-

Predicted SEED Role

"Macrolide-specific efflux protein MacA" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P75830 at UniProt or InterPro

Protein Sequence (371 amino acids)

>b0878 putative membrane protein (VIMSS) (Escherichia coli BW25113)
MKKRKTVKKRYVIALVIVIAGLITLWRILNAPVPTYQTLIVRPGDLQQSVLATGKLDALR
KVDVGAQVSGQLKTLSVAIGDKVKKDQLLGVIDPEQAENQIKEVEATLMELRAQRQQAEA
ELKLARVTYSRQQRLAQTKAVSQQDLDTAATEMAVKQAQIGTIDAQIKRNQASLDTAKTN
LDYTRIVAPMAGEVTQITTLQGQTVIAAQQAPNILTLADMSAMLVKAQVSEADVIHLKPG
QKAWFTVLGDPLTRYEGQIKDVLPTPEKVNDAIFYYARFEVPNPNGLLRLDMTAQVHIQL
TDVKNVLTIPLSALGDPVGDNRYKVKLLRNGETREREVTIGARNDTDVEIVKGLEAGDEV
VIGEAKPGAAQ