Protein Info for b0872 in Escherichia coli BW25113

Name: hcr
Annotation: HCP oxidoreductase, NADH-dependent (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 PF00970: FAD_binding_6" amino acids 37 to 104 (68 residues), 26.4 bits, see alignment E=1.2e-09 PF00175: NAD_binding_1" amino acids 116 to 210 (95 residues), 30.2 bits, see alignment E=9.2e-11 PF00111: Fer2" amino acids 247 to 316 (70 residues), 61.4 bits, see alignment E=9.8e-21

Best Hits

Swiss-Prot: 100% identical to HCR_ECOLI: NADH oxidoreductase HCR (hcr) from Escherichia coli (strain K12)

KEGG orthology group: K11933, NADH oxidoreductase Hcr [EC: 1.-.-.-] (inferred from 100% identity to eco:b0872)

MetaCyc: 100% identical to NADH oxidoreductase (Escherichia coli K-12 substr. MG1655)
1.6.-.-

Predicted SEED Role

"NADH oxidoreductase hcr (EC 1.-.-.-)" in subsystem Nitrosative stress (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P75824 at UniProt or InterPro

Protein Sequence (322 amino acids)

>b0872 HCP oxidoreductase, NADH-dependent (NCBI) (Escherichia coli BW25113)
MTMPTNQCPWRMQVHHITQETPDVWTISLICHDYYPYRAGQYALVSVRNSAETLRAYTIS
STPGVSEYITLTVRRIDDGVGSQWLTRDVKRGDYLWLSDAMGEFTCDDKAEDKFLLLAAG
CGVTPIMSMRRWLAKNRPQADVRVIYNVRTPQDVIFADEWRNYPVTLVAENNVTEGFIAG
RLTRELLAGVPDLASRTVMTCGPAPYMDWVEQEVKALGVTRFFKEKFFTPVAEAATSGLK
FTKLQPAREFYAPVGTTLLEALESNNVPVVAACRAGVCGCCKTKVVSGEYTVSSTMTLTD
AEIAEGYVLACSCHPQGDLVLA