Protein Info for b0864 in Escherichia coli BW25113

Name: artP
Annotation: arginine transporter subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 19 to 170 (152 residues), 136.3 bits, E=1.2e-43
• PF13304: AAA_21
  • amino acids 141 to 198 (58 residues), 29.9 bits, E=5.6e-11

Best Hits

Swiss-Prot: 100% identical to ARTP_ECOLI: Arginine transport ATP-binding protein ArtP (artP) from Escherichia coli (strain K12)

KEGG orthology group: K10000, arginine transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 100% identity to eco:b0864)

MetaCyc: 100% identical to L-arginine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-4-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Arginine ABC transporter, ATP-binding protein ArtP" in subsystem Arginine and Ornithine Degradation

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.4.2.1

Sequence Analysis Tools

See P0AAF6 at UniProt or InterPro

Protein Sequence (242 amino acids)

>b0864 arginine transporter subunit (NCBI) (Escherichia coli BW25113)
MSIQLNGINCFYGAHQALFDITLDCPQGETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLN
IAGNHFDFTKTPSDKAIRDLRRNVGMVFQQYNLWPHLTVQQNLIEAPCRVLGLSKDQALA
RAEKLLERLRLKPYSDRYPLHLSGGQQQRVAIARALMMEPQVLLFDEPTAALDPEITAQI
VSIIRELAETNITQVIVTHEVEVARKTASRVVYMENGHIVEQGDASCFTEPQTEAFKNYL
SH