Protein Info for b0859 in Escherichia coli BW25113

Name: rumB
Annotation: 23S rRNA m(5)U747-methyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02085: 23S rRNA (uracil-5-)-methyltransferase RumB
  • amino acids 2 to 374 (373 residues), 735.9 bits, E=4.5e-226
• PF05958: tRNA_U5-meth_tr
  • amino acids 208 to 374 (167 residues), 60.5 bits, E=2.3e-20
• PF05175: MTS
  • amino acids 235 to 310 (76 residues), 24.9 bits, E=2.1e-09
• PF13847: Methyltransf_31
  • amino acids 236 to 294 (59 residues), 30.8 bits, E=3.5e-11

Best Hits

Swiss-Prot: 100% identical to RLMC_ECODH: 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC (rlmC) from Escherichia coli (strain K12 / DH10B)

KEGG orthology group: K03212, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 100% identity to eco:b0859)

MetaCyc: 100% identical to 23S rRNA m5U747 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11600 [EC: 2.1.1.189]

Predicted SEED Role

"23S rRNA (Uracil-5-) -methyltransferase rumB (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.189

Sequence Analysis Tools

See P75817 at UniProt or InterPro

Protein Sequence (375 amino acids)

>b0859 23S rRNA m(5)U747-methyltransferase (NCBI) (Escherichia coli BW25113)
MQCALYDAGRCRSCQWIMQPIPEQLSAKTADLKNLLADFPVEEWCAPVSGPEQGFRNKAK
MVVSGSVEKPLLGMLHRDGTPEDLCDCPLYPASFAPVFAALKPFIARAGLTPYNVARKRG
ELKYILLTESQSDGGMMLRFVLRSDTKLAQLRKALPWLHEQLPQLKVITVNIQPVHMAIM
EGETEIYLTEQQALAERFNDVPLWIRPQSFFQTNPAVASQLYATARDWVRQLPVKHMWDL
FCGVGGFGLHCATPDMQLTGIEIASEAIACAKQSAAELGLTRLQFQALDSTQFATAQGDV
PELVLVNPPRRGIGKPLCDYLSTMAPRFIIYSSCNAQTMAKDIRELPGFRIERVQLFDMF
PHTAHYEVLTLLVKQ