Protein Info for b0858 in Escherichia coli BW25113

Name: ybjO
Annotation: predicted inner membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 63 to 84 (22 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details PF10767: YbjO_DH-like" amino acids 21 to 160 (140 residues), 218.9 bits, see alignment E=1.2e-69

Best Hits

Swiss-Prot: 100% identical to YBJO_ECO57: Inner membrane protein YbjO (ybjO) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to eco:b0858)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AAZ0 at UniProt or InterPro

Protein Sequence (162 amino acids)

>b0858 predicted inner membrane protein (NCBI) (Escherichia coli BW25113)
MEDETLGFFKKTSSSHARLNVPALVQVAALAIIMIRGLDVLMIFNTLGVRGIGEFIHRSV
QTWSLTLVFLSSLVLVFIEIWCAFSLVKGRRWARWLYLLTQITAASYLWAASLGYGYPEL
FSIPGESKREIFHSLMLQKLPDMLILMLLFVPSTSRRFFQLQ