Protein Info for b0841 in Escherichia coli BW25113

Name: ybjG
Annotation: undecaprenyl pyrophosphate phosphatase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF14378: PAP2_3
  • amino acids 12 to 160 (149 residues), 28.2 bits, E=1.6e-10
• PF01569: PAP2
  • amino acids 58 to 162 (105 residues), 54.4 bits, E=1.2e-18

Best Hits

Swiss-Prot: 100% identical to YBJG_ECOLI: Putative undecaprenyl-diphosphatase YbjG (ybjG) from Escherichia coli (strain K12)

KEGG orthology group: K06153, undecaprenyl-diphosphatase [EC: 3.6.1.27] (inferred from 100% identity to eco:b0841)

MetaCyc: 100% identical to undecaprenyl pyrophosphate phosphatase (Escherichia coli K-12 substr. MG1655)
Undecaprenyl-diphosphatase. [EC: 3.6.1.27]

Predicted SEED Role

"Putative permease"

MetaCyc Pathways

• polyisoprenoid biosynthesis (E. coli) (5/5 steps found)
• di-trans,poly-cis-undecaprenyl phosphate biosynthesis (2/2 steps found)

KEGG Metabolic Maps

• Peptidoglycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.27

Use Curated BLAST to search for 3.6.1.27

Sequence Analysis Tools

See P75806 at UniProt or InterPro

Protein Sequence (198 amino acids)

>b0841 undecaprenyl pyrophosphate phosphatase (NCBI) (Escherichia coli BW25113)
MLENLNLSLFSLINATPDSAPWMISLAIFIAKDLITVVPLLAVVLWLWGLTAQRQLVIKI
AIALAVSLFVSWTMGHLFPHDRPFVENIGYNFLHHAADDSFPSDHGTVIFTFALAFLCWH
RLWSGSLLMVLAVVIAWSRVYLGVHWPLDMLGGLLAGMIGCLSAQIIWQAMGHKLYQRLQ
SWYRVCFALPIRKGWVRD