Protein Info for b0834 in Escherichia coli BW25113

Name: yliF
Annotation: predicted diguanylate cyclase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 225 to 251 (27 residues), see Phobius details PF17156: GAPES2" amino acids 26 to 229 (204 residues), 475.4 bits, see alignment E=1.8e-147 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 294 to 439 (146 residues), 89.7 bits, see alignment E=8.9e-30 PF00990: GGDEF" amino acids 295 to 437 (143 residues), 87 bits, see alignment E=1.3e-28

Best Hits

Swiss-Prot: 100% identical to DGCI_ECOLI: Probable diguanylate cyclase DgcI (dgcI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b0834)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P75801 at UniProt or InterPro

Protein Sequence (442 amino acids)

>b0834 predicted diguanylate cyclase (NCBI) (Escherichia coli BW25113)
MSRINKFVLTVSLLIFIMISAVACGIYTQMVKERVYSLKQSVIDTAFAVANIAEYRRSVA
IDLINTLNPTEEQLLVGLRTAYADSVSPSYLYDVGPYLISSDECIQVKEFEKNYCADIMQ
VVKYRHVKNTGFISFDGKTFVYYLYPVTHNRSLIFLLGLERFSLLSKSLAMDSENLMFSL
FKNGKPVTGDEYNAKNAIFTVSEAMEHFAYLPTGLYVFAYKKDVYLRVCTLIIFFAALVA
VISGASCLYLVRRVINRGIVEKEAIINNHFERVLDGGLFFSAADVKKLYSMYNSAFLDDL
TKAMGRKSFDEDLKALPEKGGYLCLFDVDKFKNINDTFGHLLGDEVLMKVVKILKSQIPV
DKGKVYRFGGDEFAVIYTGGTLEELLSILKEIVHFQVGSINLSTSIGVAHSNECPTVERL
KMLADERLYKSKKNGRAQISWQ