Protein Info for b0832 in Escherichia coli BW25113

Name: yliD
Annotation: predicted peptide transporter subunit: membrane component of ABC superfamily (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 40 to 61 (22 residues), see Phobius details amino acids 103 to 128 (26 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details amino acids 221 to 246 (26 residues), see Phobius details amino acids 267 to 289 (23 residues), see Phobius details PF12911: OppC_N" amino acids 25 to 75 (51 residues), 62.2 bits, see alignment 3.5e-21 PF00528: BPD_transp_1" amino acids 119 to 302 (184 residues), 115.1 bits, see alignment E=3.2e-37

Best Hits

Swiss-Prot: 100% identical to GSID_ECOLI: Glutathione transport system permease protein GsiD (gsiD) from Escherichia coli (strain K12)

KEGG orthology group: K13891, glutathione transport system permease protein (inferred from 100% identity to eco:b0832)

MetaCyc: 100% identical to glutathione ABC transporter membrane subunit GsiD (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P75799 at UniProt or InterPro

Protein Sequence (303 amino acids)

>b0832 predicted peptide transporter subunit: membrane component of ABC superfamily (NCBI) (Escherichia coli BW25113)
MRLFNWRRQAVLNAMPLVKPDQVRTPWHEFWRRFRRQHMAMTAALFVILLIVVAIFARWI
APYDAENYFDYDNLNNGPSLQHWFGVDSLGRDIFSRVLVGAQISLAAGVFAVFIGAAIGT
LLGLLAGYYEGWWDRLIMRICDVLFAFPGILLAIAVVAVLGSGIANVIIAVAIFSIPAFA
RLVRGNTLVLKQQTFIESARSIGASDMTVLLRHILPGTVSSIVVFFTMRIGTSIISAASL
SFLGLGAQPPTPEWGAMLNEARADMVIAPHVAVFPALAIFLTVLAFNLLGDGLRDALDPK
IKG