Protein Info for b0828 in Escherichia coli BW25113

Name: iaaA
Annotation: L-asparaginase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF01112: Asparaginase_2" amino acids 3 to 309 (307 residues), 392.9 bits, see alignment E=5.1e-122

Best Hits

Swiss-Prot: 100% identical to IAAA_ECOLI: Isoaspartyl peptidase (iaaA) from Escherichia coli (strain K12)

KEGG orthology group: K13051, beta-aspartyl-peptidase (threonine type) [EC: 3.4.19.5] (inferred from 100% identity to eco:b0828)

MetaCyc: 100% identical to isoaspartyl dipeptidase proenzyme (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Isoaspartyl aminopeptidase (EC 3.4.19.5) @ Asp-X dipeptidase" (EC 3.4.19.5)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.19.5

Use Curated BLAST to search for 3.4.19.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P37595 at UniProt or InterPro

Protein Sequence (321 amino acids)

>b0828 L-asparaginase (NCBI) (Escherichia coli BW25113)
MGKAVIAIHGGAGAISRAQMSLQQELRYIEALSAIVETGQKMLEAGESALDVVTEAVRLL
EECPLFNAGIGAVFTRDETHELDACVMDGNTLKAGAVAGVSHLRNPVLAARLVMEQSPHV
MMIGEGAENFAFARGMERVSPEIFSTSLRYEQLLAARKEGATVLDHSGAPLDEKQKMGTV
GAVALDLDGNLAAATSTGGMTNKLPGRVGDSPLVGAGCYANNASVAVSCTGTGEVFIRAL
AAYDIAALMDYGGLSLAEACERVVMEKLPALGGSGGLIAIDHEGNVALPFNTEGMYRAWG
YAGDTPTTGIYREKGDTVATQ