Protein Info for b0825 in Escherichia coli BW25113
Name: mipB
Annotation: putative transaldolase (VIMSS)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to FSAA_ECOLI: Fructose-6-phosphate aldolase 1 (fsaA) from Escherichia coli (strain K12)
KEGG orthology group: K08313, fructose-6-phosphate aldolase 1 [EC: 4.1.2.-] (inferred from 100% identity to eco:b0825)MetaCyc: 100% identical to fructose-6-phosphate aldolase 1 (Escherichia coli K-12 substr. MG1655)
4.1.2.-
Predicted SEED Role
"Transaldolase (EC 2.2.1.2)" in subsystem Folate Biosynthesis or Fructose utilization or Pentose phosphate pathway (EC 2.2.1.2)
MetaCyc Pathways
- superpathway of glucose and xylose degradation (17/17 steps found)
- pentose phosphate pathway (8/8 steps found)
- Bifidobacterium shunt (13/15 steps found)
- Rubisco shunt (9/10 steps found)
- pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
- formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
- formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Fructose and mannose metabolism
- Lysine degradation
- Naphthalene and anthracene degradation
- Pentose phosphate pathway
- Phenylalanine, tyrosine and tryptophan biosynthesis
- Tyrosine metabolism
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.2.1.2, 4.1.2.-
Use Curated BLAST to search for 2.2.1.2 or 4.1.2.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See P78055 at UniProt or InterPro
Protein Sequence (220 amino acids)
>b0825 putative transaldolase (VIMSS) (Escherichia coli BW25113) MELYLDTSDVVAVKALSRIFPLAGVTTNPSIIAAGKKPLDVVLPQLHEAMGGQGRLFAQV MATTAEGMVNDALKLRSIIADIVVKVPVTAEGLAAIKMLKAEGIPTLGTAVYGAAQGLLS ALAGAEYVAPYVNRIDAQGGSGIQTVTDLHQLLKMHAPQAKVLAASFKTPRQALDCLLAG CESITLPLDVAQQMISYPAVDAAVAKFEQDWQGAFGRTSI