Protein Info for b0817 in Escherichia coli BW25113

Name: mntR
Annotation: DNA-binding transcriptional regulator of mntH (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 PF01325: Fe_dep_repress" amino acids 38 to 92 (55 residues), 41.4 bits, see alignment E=2.6e-14 PF01047: MarR" amino acids 48 to 85 (38 residues), 27.6 bits, see alignment E=4.5e-10 PF13412: HTH_24" amino acids 48 to 85 (38 residues), 24 bits, see alignment E=4.6e-09 PF02742: Fe_dep_repr_C" amino acids 95 to 149 (55 residues), 52 bits, see alignment E=1.2e-17

Best Hits

Swiss-Prot: 100% identical to MNTR_ECOLI: Transcriptional regulator MntR (mntR) from Escherichia coli (strain K12)

KEGG orthology group: K11924, DtxR family transcriptional regulator, manganese transport regulator (inferred from 100% identity to eco:b0817)

Predicted SEED Role

"Mn-dependent transcriptional regulator MntR" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A9F1 at UniProt or InterPro

Protein Sequence (155 amino acids)

>b0817 DNA-binding transcriptional regulator of mntH (NCBI) (Escherichia coli BW25113)
MSRRAGTPTAKKVTQLVNVEEHVEGFRQVREAHRRELIDDYVELISDLIREVGEARQVDM
AARLGVSQPTVAKMLKRLATMGLIEMIPWRGVFLTAEGEKLAQESRERHQIVENFLLVLG
VSPEIARRDAEGMEHHVSEETLDAFRLFTQKHGAK