Protein Info for b0804 in Escherichia coli BW25113

Name: ybiX
Annotation: putative enzyme (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 PF13640: 2OG-FeII_Oxy_3" amino acids 84 to 176 (93 residues), 55.5 bits, see alignment E=9.2e-19 PF18331: PKHD_C" amino acids 182 to 224 (43 residues), 66.7 bits, see alignment 1.5e-22

Best Hits

Swiss-Prot: 100% identical to YBIX_ECOLI: PKHD-type hydroxylase YbiX (ybiX) from Escherichia coli (strain K12)

KEGG orthology group: K07336, PKHD-type hydroxylase [EC: 1.14.11.-] (inferred from 100% identity to eco:b0804)

Predicted SEED Role

"Iron-uptake factor PiuC" in subsystem Transport of Iron

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.11.-

Use Curated BLAST to search for 1.14.11.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P75779 at UniProt or InterPro

Protein Sequence (225 amino acids)

>b0804 putative enzyme (VIMSS) (Escherichia coli BW25113)
MMYHIPGVLSPQDVARFREQLEQAEWVDGRVTTGAQGAQVKNNQQVDTRSTLYAALQNEV
LNAVNQHALFFAAALPRTLSTPLFNRYQNNETYGFHVDGAVRSHPQNGWMRTDLSATLFL
SDPQSYDGGELVVNDTFGQHRVKLPAGDLVLYPSSSLHCVTPVTRGVRVASFMWIQSMIR
DDKKRAMLFELDNNIQSLKSRYGESEEILSLLNLYHNLLREWSEI