Protein Info for b0798 in Escherichia coli BW25113

Name: ybiA
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02464: conserved hypothetical protein
  • amino acids 17 to 156 (140 residues), 169.2 bits, E=3.8e-54
• PF08719: NADAR
  • amino acids 19 to 156 (138 residues), 132 bits, E=1.3e-42

Best Hits

Swiss-Prot: 100% identical to RIBX_ECOLI: N-glycosidase YbiA (ybiA) from Escherichia coli (strain K12)

KEGG orthology group: K09935, hypothetical protein (inferred from 100% identity to eco:b0798)

MetaCyc: 100% identical to N-glycosidase YbiA (Escherichia coli K-12 substr. MG1655)
RXN-19407

Predicted SEED Role

"Uncharacterized domain COG3236 / GTP cyclohydrolase II (EC 3.5.4.25)" in subsystem Molybdenum cofactor biosynthesis or Riboflavin, FMN and FAD metabolism (EC 3.5.4.25)

MetaCyc Pathways

• flavin biosynthesis I (bacteria and plants) (9/9 steps found)
• flavin biosynthesis III (fungi) (8/9 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis III (Chlamydia) (3/5 steps found)
• toxoflavin biosynthesis (4/7 steps found)
• flavin biosynthesis II (archaea) (6/10 steps found)

KEGG Metabolic Maps

• Riboflavin metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.25

Use Curated BLAST to search for 3.5.4.25

Sequence Analysis Tools

See P30176 at UniProt or InterPro

Protein Sequence (160 amino acids)

>b0798 hypothetical protein (NCBI) (Escherichia coli BW25113)
MPVRAQRIQHVMQDTIINFYSTSDDYGDFSNFAAWPIKVDGKTWPTSEHYFQAQKFLDEK
YREEIRRVSSPMVAARMGRDRSKPLRKNWESVKEQVMRKALRAKFEQHAELRALLLATAP
AKLVEHTENDAYWGDGGHGKGKNRLGYLLMELREQLAIEK