Protein Info for b0790 in Escherichia coli BW25113

Name: ybhP
Annotation: predicted DNase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 PF03372: Exo_endo_phos" amino acids 14 to 244 (231 residues), 85.4 bits, see alignment E=2.4e-28

Best Hits

Swiss-Prot: 100% identical to YBHP_ECOL6: Uncharacterized protein YbhP (ybhP) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K06896, (no description) (inferred from 100% identity to eco:b0790)

Predicted SEED Role

"Endonuclease/Exonuclease/phosphatase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AAW1 at UniProt or InterPro

Protein Sequence (253 amino acids)

>b0790 predicted DNase (NCBI) (Escherichia coli BW25113)
MPDQTQQFSFKVLTINIHKGFTAFNRRFILPELRDAVRTVSADIVCLQEVMGAHEVHPLH
VENWPDTSHYEFLADTMWSDFAYGRNAVYPEGHHGNAVLSRYPIEHYENRDVSVDGAEKR
GVLYCRIVPPMTGKAIHVMCVHLGLREAHRQAQLAMLAEWVNELPDGEPVLVAGDFNDWR
QKANHPLKVQAGLDEIFTRAHGRPARTFPVQFPLLRLDRIYVKNASASAPTALPLRTWRH
LSDHAPLSAEIHL