Protein Info for b0789 in Escherichia coli BW25113

Name: ybhO
Annotation: cardiolipin synthase 2 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13091: PLDc_2
  • amino acids 26 to 136 (111 residues), 49.5 bits, E=3.9e-17
  • amino acids 213 to 337 (125 residues), 100.9 bits, E=5.2e-33
• PF00614: PLDc
  • amino acids 109 to 132 (24 residues), 31.1 bits, see alignment (E = 1.7e-11)

Best Hits

Swiss-Prot: 100% identical to CLSB_ECOLI: Cardiolipin synthase B (clsB) from Escherichia coli (strain K12)

KEGG orthology group: K06132, putative cardiolipin synthase [EC: 2.7.8.-] (inferred from 100% identity to eco:b0789)

MetaCyc: 100% identical to cardiolipin synthase B (Escherichia coli K-12 substr. MG1655)
CARDIOLIPSYN-RXN [EC: 2.7.8.41]; RXN0-7272 [EC: 2.7.8.41]

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

• superpathway of phospholipid biosynthesis III (E. coli) (12/12 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (11/13 steps found)
• cardiolipin biosynthesis I (3/3 steps found)
• cardiolipin biosynthesis II (3/3 steps found)
• cardiolipin biosynthesis III (3/3 steps found)
• cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (3/4 steps found)

KEGG Metabolic Maps

• Aminophosphonate metabolism
• Glycerophospholipid metabolism
• High-mannose type N-glycan biosynthesis
• Nucleotide sugars metabolism
• Sphingolipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.- or 2.7.8.41

Sequence Analysis Tools

See P0AA84 at UniProt or InterPro

Protein Sequence (413 amino acids)

>b0789 cardiolipin synthase 2 (NCBI) (Escherichia coli BW25113)
MKCSWREGNKIQLLENGEQYYPAVFKAIGEAQERIILETFIWFEDDVGKQLHAALLAAAQ
RGVKAEVLLDGYGSPDLSDEFVNELTAAGVVFRYYDPRPRLFGMRTNVFRRMHRKIVVID
ARIAFIGGLNYSAEHMSSYGPEAKQDYAVRLEGPIVEDILQFELENLPGQSAARRWWRRH
HKAEENRQPGEAQVLLVWRDNEEHRDDIERHYLKMLTQARREVIIANAYFFPGYRFLHAL
RKAARRGVRIKLIIQGEPDMPIVRVGARLLYNYLVKGGVQVFEYRRRPLHGKVALMDDHW
ATVGSSNLDPLSLSLNLEANVIIHDRHFNQTLRDNLNGIIAADCQQVDETMLPKRTWWNL
TKSVLAFHFLRHFPALVGWLPAHTPRLAQVDPPAQPTMETQDRVETENTGVKP