Protein Info for b0788 in Escherichia coli BW25113

Name: ybhN
Annotation: conserved inner membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 49 to 71 (23 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 127 to 153 (27 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 205 to 227 (23 residues), see Phobius details amino acids 234 to 266 (33 residues), see Phobius details amino acids 278 to 303 (26 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 21 to 295 (275 residues), 58 bits, see alignment E=5.6e-20

Best Hits

Swiss-Prot: 100% identical to YBHN_ECOLI: Inner membrane protein YbhN (ybhN) from Escherichia coli (strain K12)

KEGG orthology group: K07027, (no description) (inferred from 100% identity to eco:b0788)

Predicted SEED Role

"Inner membrane protein YbhQ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P75770 at UniProt or InterPro

Protein Sequence (318 amino acids)

>b0788 conserved inner membrane protein (NCBI) (Escherichia coli BW25113)
MSKSHPRWRLAKKILTWLFFIAVIVLLVVYAKKVDWEEVWKVIRDYNRVALLSAVGLVVV
SYLIYGCYDLLARFYCGHKLAKRQVMLVSFICYAFNLTLSTWVGGIGMRYRLYSRLGLPG
STITRIFSLSITTNWLGYILLAGIIFTAGVVELPDHWYVDQTTLRILGIGLLMIIAVYLW
FCAFAKHRHMTIKGQKLVLPSWKFALAQMLISSVNWMVMGAIIWLLLGQSVNYFFVLGVL
LVSSIAGVIVHIPAGIGVLEAVFIALLAGEHTSKGTIIAALLAYRVLYYFIPLLLALICY
LLLESQAKKLRAKNEAAM