Protein Info for b0756 in Escherichia coli BW25113

Name: galM
Annotation: galactose-1-epimerase (mutarotase) (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 TIGR02636: galactose mutarotase" amino acids 12 to 343 (332 residues), 497.2 bits, see alignment E=1.1e-153 PF01263: Aldose_epim" amino acids 17 to 342 (326 residues), 306 bits, see alignment E=1.6e-95

Best Hits

Swiss-Prot: 100% identical to GALM_ECOLI: Aldose 1-epimerase (galM) from Escherichia coli (strain K12)

KEGG orthology group: K01785, aldose 1-epimerase [EC: 5.1.3.3] (inferred from 100% identity to eco:b0756)

MetaCyc: 100% identical to galactose-1-epimerase (Escherichia coli K-12 substr. MG1655)
Aldose 1-epimerase. [EC: 5.1.3.3]

Predicted SEED Role

"Aldose 1-epimerase (EC 5.1.3.3)" in subsystem Lactose and Galactose Uptake and Utilization or Maltose and Maltodextrin Utilization (EC 5.1.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A9C3 at UniProt or InterPro

Protein Sequence (346 amino acids)

>b0756 galactose-1-epimerase (mutarotase) (NCBI) (Escherichia coli BW25113)
MLNETPALAPDGQPYRLLTLRNNAGMVVTLMDWGATLLSARIPLSDGSVREALLGCASPE
CYQDQAAFLGASIGRYANRIANSRYTFDGETVTLSPSQGVNQLHGGPEGFDKRRWQIVNQ
NDRQVLFALSSDDGDQGFPGNLGATVQYRLTDDNRISITYRATVDKPCPVNMTNHVYFNL
DGEQSDVRNHKLQILADEYLPVDEGGIPHDGLKSVAGTSFDFRSAKIIASEFLADDDQRK
VKGYDHAFLLQAKGDGKKVAAHVWSADEKLQLKVYTTAPALQFYSGNFLGGTPSRGTEPY
ADWQGLALESEFLPDSPNHPEWPQPDCFLRPGEEYSSLTEYQFIAE