Protein Info for b0753 in Escherichia coli BW25113

Name: ybgS
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13985: YbgS" amino acids 3 to 126 (124 residues), 207.3 bits, see alignment E=3.5e-66

Best Hits

Swiss-Prot: 100% identical to YBGS_SHIFL: Uncharacterized protein YbgS (ybgS) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to eco:b0753)

Predicted SEED Role

"Probable secreted protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AAV6 at UniProt or InterPro

Protein Sequence (126 amino acids)

>b0753 hypothetical protein (NCBI) (Escherichia coli BW25113)
MKMTKLATLFLTATLSLASGAALAADSGAQTNNGQANAAADAGQVAPDARENVAPNNVDN
NGVNTGSGGTMLHSDGSSMNNDGMTKDEEHKNTMCKDGRCPDINKKVQTGDGINNDVDTK
TDGTTQ