Protein Info for b0731 in Escherichia coli BW25113

Name: mngA
Annotation: fused 2-O-a-mannosyl-D-glycerate specific PTS enzymes: IIA component/IIB component/IIC component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 658 transmembrane" amino acids 310 to 337 (28 residues), see Phobius details amino acids 357 to 376 (20 residues), see Phobius details amino acids 388 to 414 (27 residues), see Phobius details amino acids 434 to 454 (21 residues), see Phobius details amino acids 466 to 487 (22 residues), see Phobius details amino acids 498 to 518 (21 residues), see Phobius details amino acids 523 to 540 (18 residues), see Phobius details amino acids 552 to 567 (16 residues), see Phobius details amino acids 575 to 597 (23 residues), see Phobius details amino acids 616 to 641 (26 residues), see Phobius details TIGR00848: PTS system, fructose subfamily, IIA component" amino acids 27 to 154 (128 residues), 131.8 bits, see alignment E=2.1e-42 PF00359: PTS_EIIA_2" amino acids 29 to 169 (141 residues), 115.7 bits, see alignment E=2.6e-37 TIGR00829: PTS system, Fru family, IIB component" amino acids 187 to 268 (82 residues), 79 bits, see alignment E=3.9e-26 PF02302: PTS_IIB" amino acids 188 to 279 (92 residues), 67.6 bits, see alignment E=1.9e-22 TIGR01427: PTS system, Fru family, IIC component" amino acids 296 to 641 (346 residues), 275.4 bits, see alignment E=1.3e-85 PF02378: PTS_EIIC" amino acids 312 to 564 (253 residues), 40.8 bits, see alignment E=2.3e-14

Best Hits

Swiss-Prot: 100% identical to MNGA_ECOLI: PTS system 2-O-alpha-mannosyl-D-glycerate-specific EIIABC component (mngA) from Escherichia coli (strain K12)

KEGG orthology group: K11198, PTS system, 2-O-A-mannosyl-D-glycerate-specific IIA component [EC: 2.7.1.69] K11199, PTS system, 2-O-A-mannosyl-D-glycerate-specific IIB component [EC: 2.7.1.69] K11200, PTS system, 2-O-A-mannosyl-D-glycerate-specific IIC component (inferred from 100% identity to eco:b0731)

MetaCyc: 100% identical to 2-O-alpha-mannosyl-D-glycerate specific PTS enzyme II (Escherichia coli K-12 substr. MG1655)
RXN0-2522 [EC: 2.7.1.195]

Predicted SEED Role

"PTS system, 2-O-alpha-mannosyl-D-glycerate-specific IIA component / PTS system, 2-O-alpha-mannosyl-D-glycerate-specific IIB component / PTS system, 2-O-alpha-mannosyl-D-glycerate-specific IIC component"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.195 or 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P54745 at UniProt or InterPro

Protein Sequence (658 amino acids)

>b0731 fused 2-O-a-mannosyl-D-glycerate specific PTS enzymes: IIA component/IIB component/IIC component (NCBI) (Escherichia coli BW25113)
MVLFYRAHWRDYKNDQVRIMMNLTTLTHRDALCLNARFTSREEAIHALTQRLAALGKISS
TEQFLEEVYRRESLGPTALGEGLAVPHGKTAAVKEAAFAVATLSEPLQWEGVDGPEAVDL
VVLLAIPPNEAGTTHMQLLTALTTRLADDEIRARIQSATTPDELLSALDDKGGTQPSASF
SNAPTIVCVTACPAGIAHTYMAAEYLEKAGRKLGVNVYVEKQGANGIEGRLTADQLNSAT
ACIFAAEVAIKESERFNGIPALSVPVAEPIRHAEALIQQALTLKRSDETRTVQQDTQPVK
SVKTELKQALLSGISFAVPLIVAGGTVLAVAVLLSQIFGLQDLFNEENSWLWMYRKLGGG
LLGILMVPVLAAYTAYSLADKPALAPGFAAGLAANMIGSGFLGAVVGGLIAGYLMRWVKN
HLRLSSKFNGFLTFYLYPVLGTLGAGSLMLFVVGEPVAWINNSLTAWLNGLSGSNALLLG
AILGFMCSFDLGGPVNKAAYAFCLGAMANGVYGPYAIFASVKMVSAFTVTASTMLAPRLF
KEFEIETGKSTWLLGLAGITEGAIPMAIEDPLRVIGSFVLGSMVTGAIVGAMNIGLSTPG
AGIFSLFLLHDNGAGGVMAAIGWFGAALVGAAISTAILLMWRRHAVKHGNYLTDGVMP