Protein Info for b0715 in Escherichia coli BW25113

Name: abrB
Annotation: putative transport protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 transmembrane" amino acids 6 to 32 (27 residues), see Phobius details amino acids 52 to 74 (23 residues), see Phobius details amino acids 81 to 103 (23 residues), see Phobius details amino acids 144 to 162 (19 residues), see Phobius details amino acids 175 to 200 (26 residues), see Phobius details amino acids 207 to 224 (18 residues), see Phobius details amino acids 230 to 247 (18 residues), see Phobius details amino acids 259 to 280 (22 residues), see Phobius details amino acids 292 to 309 (18 residues), see Phobius details amino acids 315 to 340 (26 residues), see Phobius details TIGR03082: membrane protein AbrB duplication" amino acids 6 to 160 (155 residues), 138.1 bits, see alignment E=1.1e-44 amino acids 183 to 339 (157 residues), 155.1 bits, see alignment E=6.7e-50 PF05145: AbrB" amino acids 29 to 339 (311 residues), 327.2 bits, see alignment E=4.5e-102

Best Hits

Swiss-Prot: 100% identical to ABRB_ECOLI: Putative regulator AbrB (abrB) from Escherichia coli (strain K12)

KEGG orthology group: K07120, (no description) (inferred from 100% identity to eco:b0715)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P75747 at UniProt or InterPro

Protein Sequence (348 amino acids)

>b0715 putative transport protein (VIMSS) (Escherichia coli BW25113)
MPVLQWGMLCVLSLLLSIGFLAVHLPAALLLGPMIAGIIFSMRGITLQLPRSAFLAAQAI
LGCMIAQNLTGSILTTLAVNWPIVLAILLVTLLSSAIVGWLLVRYSSLPGNTGAWGSSPG
GAAAMVAMAQDYGADIRLVAFMQYLRVLFVAGAAVLVTRMMLGDNAEAVNQHIVWFPPVS
INLLLTILLAVVAGTVGCLLRLPSGTMLIPMLAGAVLQSGQLITIELPEWLLAMAYMAIG
WRIGLGFDKQILLRALRPLPQILLSIFALLAICAGMAWGLTRFMHIDFMTAYLATSPGGL
DTVAVIAAGSNADMALIMAMQTLRLFSILLTGPAIARFISTYAPKRSA