Protein Info for b0713 in Escherichia coli BW25113

Name: ybgL
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03746: LamB_YcsF
  • amino acids 3 to 235 (233 residues), 316.5 bits, E=6.4e-99

Best Hits

Swiss-Prot: 100% identical to PXPA_ECOBW: 5-oxoprolinase subunit A (pxpA) from Escherichia coli (strain K12 / MC4100 / BW2952)

KEGG orthology group: K07160, UPF0271 protein (inferred from 100% identity to eco:b0713)

MetaCyc: 100% identical to 5-oxoprolinase component A (Escherichia coli K-12 substr. MG1655)
5-oxoprolinase (ATP-hydrolyzing). [EC: 3.5.2.9]

Predicted SEED Role

"Lactam utilization protein LamB"

MetaCyc Pathways

• γ-glutamyl cycle (5/6 steps found)
• 5-oxo-L-proline metabolism (5/6 steps found)

KEGG Metabolic Maps

• Glutathione metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.9

Sequence Analysis Tools

See P75746 at UniProt or InterPro

Protein Sequence (244 amino acids)

>b0713 hypothetical protein (NCBI) (Escherichia coli BW25113)
MKIDLNADLGEGCASDAELLTLVSSANIACGFHAGDAQIMQACVREAIKNGVAIGAHPSF
PDRENFGRSAMQLPPETVYAQTLYQIGALATIARAQGGVMRHVKPHGMLYNQAAKEAQLA
DAIARAVYACDPALILVGLAGSELIRAGKQYGLTTREEVFADRGYQADGSLVPRSQSGAL
IENEEQALAQTLEMVQHGRVKSITGEWATVAAQTVCLHGDGEHALAFARRLRSAFAEKGI
VVAA