Protein Info for b0702 in Escherichia coli BW25113

Name: ybfB
Annotation: predicted inner membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 44 to 68 (25 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details

Best Hits

Swiss-Prot: 100% identical to YBFB_ECO57: Uncharacterized protein YbfB (ybfB) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to eco:b0702)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AAU5 at UniProt or InterPro

Protein Sequence (108 amino acids)

>b0702 predicted inner membrane protein (NCBI) (Escherichia coli BW25113)
MKYIIFLFRAIWLALSLLILFFSMHRLSLLDSTRDVSELISLMSYGMMVICFPTGIVFFI
ALIFIGTVSDIIGVRIDSKYIMAIIIWLYFLSGGYIQWFVLSKRIINK