Protein Info for b0646 in Escherichia coli BW25113

Name: djlB
Annotation: predicted chaperone (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 transmembrane" amino acids 452 to 474 (23 residues), see Phobius details PF27158: DjlB_C_2nd" amino acids 72 to 162 (91 residues), 68.9 bits, see alignment E=1.6e-23

Best Hits

Swiss-Prot: 100% identical to DJLB_ECOLI: Uncharacterized J domain-containing protein DjlB (djlB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b0646)

Predicted SEED Role

"FIG00638911: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77381 at UniProt or InterPro

Protein Sequence (475 amino acids)

>b0646 predicted chaperone (NCBI) (Escherichia coli BW25113)
MKNCWKILDIEETTDVDIIRRAYLALLPSFHPETDPQGFKQLRQAYEEALRIAQSPAKSV
WQPEEYEVAEHEILLAFRALLASDSERFLPSAWQRFIQQLNYCSMEEIDELRWSLCTIAM
NTAHLSFECVVLLAERLRWLQEENTGEIDEEELESFLYAIAKGNVFNFQTILHLPVAVQN
DTIDFYQMFARIWSSHPQWLTLYLAQHRAVIIPDDAKLHRNLLRWYSAGRLDIPELLDYA
QSWRETEPDNEDAPYYEYAQRVYCGEGESLLAELCDYWREYPSTQADALMLQWCRQHRVD
YYPLLVMMIEARDLVNDQGKPLLYVPGDSARTRFHLYEILSDEKLSALGRSLVEMVLHKG
RKPRISLTRDTEHTLWPLYLVAKQLVQACQPTEESLMPIVSRLDAENRCPLEALIIRRLL
IQAANFTEKQTVEPEPQPQPMPVDDGGPGCLGIIKIIFYIFIFAGLIGKILHLFG