Protein Info for b0644 in Escherichia coli BW25113

Name: ybeQ
Annotation: orf, hypothetical protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 PF08238: Sel1" amino acids 26 to 61 (36 residues), 28.9 bits, see alignment 6.2e-11 amino acids 63 to 97 (35 residues), 21.5 bits, see alignment 1.4e-08 amino acids 100 to 130 (31 residues), 15.6 bits, see alignment (E = 1e-06) amino acids 132 to 167 (36 residues), 41.8 bits, see alignment 5.3e-15 amino acids 168 to 203 (36 residues), 37 bits, see alignment 1.8e-13 amino acids 205 to 239 (35 residues), 31.7 bits, see alignment 8.5e-12 amino acids 242 to 275 (34 residues), 42.5 bits, see alignment 3.3e-15 amino acids 280 to 305 (26 residues), 21.2 bits, see alignment (E = 1.7e-08)

Best Hits

Swiss-Prot: 100% identical to YBEQ_ECOLI: Sel1-repeat-containing protein YbeQ (ybeQ) from Escherichia coli (strain K12)

KEGG orthology group: K07126, (no description) (inferred from 100% identity to eco:b0644)

Predicted SEED Role

"FIG00639187: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77234 at UniProt or InterPro

Protein Sequence (325 amino acids)

>b0644 orf, hypothetical protein (VIMSS) (Escherichia coli BW25113)
MIFTSSCCDNLSIDEIIERAEKGDCEAQYIVGFYYNRDSAIDSPDDEKAFYWLKLAAEQG
HCEAQYSLGQKYTEDKSRHKDNEQAIFWLKKAALQGHTFASNALGWTLDRGEAPNYKEAV
VWYQIAAESGMSYAQNNLGWMYRNGNGVAKDYALAFFWYKQAALQGHSDAQNNLADLYED
GKGVAQNKTLAAFWYLKSAQQGNRHAQFQIAWDYNAGEGVDQDYKQAMYWYLKAAAQGSV
GAYVNIGYMYKHGQGVEKDYQAAFEWFTKAAECNDATAWYNLAIMYHYGEGRPVDLRQAL
DLYRKVQSSGTRDVSQEIRETEDLL