Protein Info for b0638 in Escherichia coli BW25113

Name: cobC
Annotation: predicted alpha-ribazole-5'-P phosphatase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 transmembrane" amino acids 144 to 161 (18 residues), see Phobius details PF00300: His_Phos_1" amino acids 3 to 194 (192 residues), 192.2 bits, see alignment E=3.9e-61 TIGR03162: alpha-ribazole phosphatase" amino acids 3 to 181 (179 residues), 202.8 bits, see alignment E=1.4e-64

Best Hits

Swiss-Prot: 100% identical to COBC_ECOLI: Adenosylcobalamin/alpha-ribazole phosphatase (cobC) from Escherichia coli (strain K12)

KEGG orthology group: K02226, alpha-ribazole phosphatase [EC: 3.1.3.73] (inferred from 100% identity to eco:b0638)

MetaCyc: 100% identical to putative adenosylcobalamin phosphatase/alpha-ribazole phosphatase (Escherichia coli K-12 substr. MG1655)
Alpha-ribazole phosphatase. [EC: 3.1.3.73]; 3.1.3.73 [EC: 3.1.3.73]

Predicted SEED Role

"Alpha-ribazole-5'-phosphate phosphatase (EC 3.1.3.73)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 3.1.3.73)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.73

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P52086 at UniProt or InterPro

Protein Sequence (203 amino acids)

>b0638 predicted alpha-ribazole-5'-P phosphatase (NCBI) (Escherichia coli BW25113)
MRLWLIRHGETQANIDGLYSGHAPTPLTARGIEQAQNLHTLLHGVSFDLVLCSELERAQH
TARLVLSDRQLPVQIIPELNEMFFGDWEMRHHRDLMQEDAENYSAWCNDWQHAIPTNGEG
FQAFSQRVERFIARLSEFQHYQNILVVSHQGVLSLLIARLIGMPAEAMWHFRVDQGCWSA
IDINQKFATLRVLNSRAIGVENA