Protein Info for b0604 in Escherichia coli BW25113

Name: dsbG
Annotation: thiol:disulfide interchange protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF10411: DsbC_N" amino acids 24 to 82 (59 residues), 42.8 bits, see alignment E=4.8e-15 PF13462: Thioredoxin_4" amino acids 110 to 168 (59 residues), 26.3 bits, see alignment E=1.2e-09 PF13098: Thioredoxin_2" amino acids 112 to 243 (132 residues), 34.8 bits, see alignment E=2.8e-12

Best Hits

Swiss-Prot: 100% identical to DSBG_ECOLI: Thiol:disulfide interchange protein DsbG (dsbG) from Escherichia coli (strain K12)

KEGG orthology group: K03805, thiol:disulfide interchange protein DsbG (inferred from 100% identity to eco:b0604)

MetaCyc: 100% identical to protein sulfenic acid reductase and chaperone DsbG (Escherichia coli K-12 substr. MG1655)
Protein disulfide-isomerase. [EC: 5.3.4.1]; RXN-20019 [EC: 5.3.4.1]

Predicted SEED Role

"Thiol:disulfide interchange protein DsbG precursor" in subsystem Periplasmic disulfide interchange

Isozymes

Compare fitness of predicted isozymes for: 5.3.4.1

Use Curated BLAST to search for 5.3.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77202 at UniProt or InterPro

Protein Sequence (248 amino acids)

>b0604 thiol:disulfide interchange protein (VIMSS) (Escherichia coli BW25113)
MLKKILLLALLPAIAFAEELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYL
TPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYV
FADPFCPYCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYE
ASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAVGLPDQKT
LNIIMGNK