Protein Info for b0603 in Escherichia coli BW25113

Name: ybdO
Annotation: predicted DNA-binding transcriptional regulator (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 229 to 249 (21 residues), see Phobius details PF00126: HTH_1" amino acids 12 to 70 (59 residues), 65.6 bits, see alignment E=3.1e-22 PF03466: LysR_substrate" amino acids 135 to 299 (165 residues), 38.6 bits, see alignment E=7.9e-14

Best Hits

Swiss-Prot: 100% identical to YBDO_ECOLI: Uncharacterized HTH-type transcriptional regulator YbdO (ybdO) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b0603)

Predicted SEED Role

"LysR-family transcriptional regulator YbeF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77746 at UniProt or InterPro

Protein Sequence (300 amino acids)

>b0603 predicted DNA-binding transcriptional regulator (NCBI) (Escherichia coli BW25113)
MANLYDLKKFDLNLLVIFECIYQHLSISKAAESLYITPSAVSQSLQRLRAQFNDPLFIRS
GKGIAPTTTGLNLHHHLEKNLRGLEQTINIVNKSELKKNFIIYGPQLISCSNNSMLIRCL
RQDSSVEIECHDILMSAENAEELLVHRKADLVITQMPVISRSVICMPLHTIRNTLICSNR
HPRITDNSTYEQIMAEEFTQLISKSAGVDDIQMEIDERFMNRKISFRGSSLLTIINSIAV
TDLLGIVPYELYNSYRDFLNLKEIKLEHPLPSIKLYISYNKSSLNNLVFSRFIDRLNESF