Protein Info for b0602 in Escherichia coli BW25113

Name: ybdN
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 PF01507: PAPS_reduct" amino acids 30 to 234 (205 residues), 52 bits, see alignment E=9.3e-18 PF11922: DUF3440" amino acids 237 to 344 (108 residues), 82 bits, see alignment E=4.8e-27 amino acids 352 to 384 (33 residues), 28.6 bits, see alignment (E = 1.1e-10)

Best Hits

Swiss-Prot: 100% identical to YBDN_ECOLI: Uncharacterized protein YbdN (ybdN) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b0602)

Predicted SEED Role

"Co-activator of prophage gene expression IbrA" in subsystem IbrA and IbrB: co-activators of prophage gene expression

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77216 at UniProt or InterPro

Protein Sequence (406 amino acids)

>b0602 hypothetical protein (NCBI) (Escherichia coli BW25113)
MSIYKIPLPLNILEAARERITWTLNTLPRVCVSFSGGKDSGLMLHLTAELARQMGKKICV
LFIDWEAQFSCTINYVQSLRELYTDVIEEFYWVALPLTTQNSLSQYQPEWQCWEPDVEWV
RQPPQDAITDPDFFCFYQPGMTFEQFVREFAEWFSQKRPAAMMIGIRADESYNRFVAIAS
LNKQRFADDKPWTTAAPGGHSWYIYPIYDWKVADIWTWYANHQSLCNPLYNLMYQAGVPL
RHMRICEPFGPEQRQGLWLYHVIEPDRWAAMCARVSGVKSGGIYAGHDNHFYGHRKILKP
EHLDWQEYALLLLNSMPEKTAEHYRNKIAIYLHWYQKKGIEVPQTQQGDIGAKDIPSWRR
ICKVLLNNDYWCRALSFSPTKSKNYQRYNERIKGKRQEWGILCNND