Protein Info for b0600 in Escherichia coli BW25113

Name: ybdL
Annotation: putative aminotransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 PF00155: Aminotran_1_2" amino acids 32 to 383 (352 residues), 202.8 bits, see alignment E=9.5e-64 PF01053: Cys_Met_Meta_PP" amino acids 96 to 204 (109 residues), 27.6 bits, see alignment E=1.1e-10

Best Hits

Swiss-Prot: 100% identical to YBDL_ECOLI: Methionine aminotransferase (ybdL) from Escherichia coli (strain K12)

KEGG orthology group: K14287, methionine aminotransferase [EC: 2.6.1.-] (inferred from 100% identity to eco:b0600)

MetaCyc: 100% identical to methionine transaminase (Escherichia coli K-12 substr. MG1655)
R15-RXN [EC: 2.6.1.88]

Predicted SEED Role

"Methionine aminotransferase, PLP-dependent" in subsystem Methionine Salvage

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.-

Use Curated BLAST to search for 2.6.1.- or 2.6.1.88

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77806 at UniProt or InterPro

Protein Sequence (386 amino acids)

>b0600 putative aminotransferase (NCBI) (Escherichia coli BW25113)
MTNNPLIPQSKLPQLGTTIFTQMSALAQQHQAINLSQGFPDFDGPRYLQERLAHHVAQGA
NQYAPMTGVQALREAIAQKTERLYGYQPDADSDITVTAGATEALYAAITALVRNGDEVIC
FDPSYDSYAPAIALSGGIVKRMALQPPHFRVDWQEFAALLSERTRLVILNTPHNPSATVW
QQADFAALWQAIAGHEIFVISDEVYEHINFSQQGHASVLAHPQLRERAVAVSSFGKTYHM
TGWKVGYCVAPAPISAEIRKVHQYLTFSVNTPAQLALADMLRAEPEHYLALPDFYRQKRD
ILVNALNESRLEILPCEGTYFLLVDYSAVSTLDDVEFCQWLTQEHGVAAIPLSVFCADPF
PHKLIRLCFAKKESTLLAAAERLRQL