Protein Info for b0596 in Escherichia coli BW25113

Name: entA
Annotation: 2,3-dihydroxybenzoate-2,3-dehydrogenase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF00106: adh_short" amino acids 6 to 185 (180 residues), 158.3 bits, see alignment E=3.5e-50 TIGR04316: 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase" amino acids 8 to 247 (240 residues), 359.5 bits, see alignment E=5.1e-112 PF13561: adh_short_C2" amino acids 12 to 245 (234 residues), 175.9 bits, see alignment E=2.2e-55 PF08659: KR" amino acids 43 to 155 (113 residues), 38.9 bits, see alignment E=1.8e-13

Best Hits

Swiss-Prot: 100% identical to ENTA_ECOLI: 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (entA) from Escherichia coli (strain K12)

KEGG orthology group: K00216, 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase [EC: 1.3.1.28] (inferred from 100% identity to eco:b0596)

MetaCyc: 100% identical to 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (Escherichia coli K-12 substr. MG1655)
2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase. [EC: 1.3.1.28]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P15047 at UniProt or InterPro

Protein Sequence (248 amino acids)

>b0596 2,3-dihydroxybenzoate-2,3-dehydrogenase (NCBI) (Escherichia coli BW25113)
MDFSGKNVWVTGAGKGIGYATALAFVEAGAKVTGFDQAFTQEQYPFATEVMDVADAAQVA
QVCQRLLAETERLDALVNAAGILRMGATDQLSKEDWQQTFAVNVGGAFNLFQQTMNQFRR
QRGGAIVTVASDAAHTPRIGMSAYGASKAALKSLALSVGLELAGSGVRCNVVSPGSTDTD
MQRTLWVSDDAEEQRIRGFGEQFKLGIPLGKIARPQEIANTILFLASDLASHITLQDIVV
DGGSTLGA