Protein Info for b0595 in Escherichia coli BW25113
Name: entB
Annotation: isochorismatase (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to ENTB_ECO57: Enterobactin synthase component B (entB) from Escherichia coli O157:H7
KEGG orthology group: K01252, enterobactin isochorismatase [EC: 3.3.2.1] (inferred from 100% identity to eco:b0595)MetaCyc: 100% identical to enterobactin synthase component B (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
No annotation
MetaCyc Pathways
- superpathway of chorismate metabolism (54/59 steps found)
- 2,3-dihydroxybenzoate biosynthesis (3/3 steps found)
- enterobactin biosynthesis (7/11 steps found)
- vibriobactin biosynthesis (4/9 steps found)
- bacillibactin biosynthesis (6/12 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.3.2.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See P0ADI4 at UniProt or InterPro
Protein Sequence (285 amino acids)
>b0595 isochorismatase (NCBI) (Escherichia coli BW25113) MAIPKLQAYALPESHDIPQNKVDWAFEPQRAALLIHDMQDYFVSFWGENCPMMEQVIANI AALRDYCKQHNIPVYYTAQPKEQSDEDRALLNDMWGPGLTRSPEQQKVVDRLTPDADDTV LVKWRYSAFHRSPLEQMLKESGRNQLIITGVYAHIGCMTTATDAFMRDIKPFMVADALAD FSRDEHLMSLKYVAGRSGRVVMTEELLPAPIPASKAALREVILPLLDESDEPFDDDNLID YGLDSVRMMALAARWRKVHGDIDFVMLAKNPTIDAWWKLLSREVK