Protein Info for b0588 in Escherichia coli BW25113

Name: fepC
Annotation: iron-enterobactin transporter subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 24 to 172 (149 residues), 119.3 bits, E=3.1e-38

Best Hits

Swiss-Prot: 100% identical to FEPC_ECOLI: Ferric enterobactin transport ATP-binding protein FepC (fepC) from Escherichia coli (strain K12)

KEGG orthology group: K02013, iron complex transport system ATP-binding protein [EC: 3.6.3.34] (inferred from 100% identity to eco:b0588)

MetaCyc: 100% identical to ferric enterobactin ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-10-RXN [EC: 7.2.2.17]

Predicted SEED Role

"Ferric enterobactin transport ATP-binding protein FepC (TC 3.A.1.14.2)" in subsystem Siderophore Enterobactin (TC 3.A.1.14.2)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.34

Use Curated BLAST to search for 3.6.3.34 or 7.2.2.17

Sequence Analysis Tools

See P23878 at UniProt or InterPro

Protein Sequence (271 amino acids)

>b0588 iron-enterobactin transporter subunit (NCBI) (Escherichia coli BW25113)
MTESVARLRGEQLTLGYGKYTVAENLTVEIPDGHFTAIIGPNGCGKSTLLRTLSRLMTPA
HGHVWLDGEHIQHYASKEVARRIGLLAQNATTPGDITVQELVARGRYPHQPLFTRWRKED
EEAVTKAMQATGITHLADQSVDTLSGGQRQRAWIAMVLAQETAIMLLDEPTTWLDISHQI
DLLELLSELNREKGYTLAAVLHDLNQACRYASHLIALREGKIVAQGAPKEIVTAELIERI
YGLRCMIIDDPVAGTPLVVPLGRTAPSTANS