Protein Info for b0585 in Escherichia coli BW25113

Name: fes
Annotation: enterobactin/ferric enterobactin esterase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 PF11806: Enterochelin_N" amino acids 3 to 129 (127 residues), 145.6 bits, see alignment E=1.2e-46 PF00756: Esterase" amino acids 146 to 365 (220 residues), 191.3 bits, see alignment E=2.5e-60

Best Hits

Swiss-Prot: 100% identical to FES_ECOLI: Enterochelin esterase (fes) from Escherichia coli (strain K12)

KEGG orthology group: K07214, enterochelin esterase and related enzymes (inferred from 100% identity to eco:b0585)

MetaCyc: 100% identical to ferric enterobactin esterase (Escherichia coli K-12 substr. MG1655)
RXN-20025 [EC: 3.1.1.108]; 3.1.1.108 [EC: 3.1.1.108]; 3.1.1.- [EC: 3.1.1.108]

Predicted SEED Role

"Enterobactin esterase" in subsystem Siderophore Enterobactin

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.108

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P13039 at UniProt or InterPro

Protein Sequence (374 amino acids)

>b0585 enterobactin/ferric enterobactin esterase (NCBI) (Escherichia coli BW25113)
MFEVTFWWRDPQGSEEYSTIKRVWVYITGVTDHHQNSQPQSMQRIAGTNVWQWTTQLNAN
WRGSYCFIPTERDDIFSVPSPDRLELREGWRKLLPQAIADPLNLQSWKGGRGHAVSALEM
PQAPLQPGWDCPQAPEIPAKEIIWKSERLKKSRRVWIFTTGDATAEERPLAVLLDGEFWA
QSMPVWPVLTSLTHRQQLPPAVYVLIDAIDTTHRAHELPCNADFWLAVQQELLPLVKAIA
PFSDRADRTVVAGQSFGGLSALYAGLHWPERFGCVLSQSGSYWWPHRGGQQEGVLLEKLK
AGEVSAEGLRIVLEAGIREPMIMRANQALYAQLHPIKESIFWRQVDGGHDALCWRGGLMQ
GLIDLWQPLFHDRS