Protein Info for b0530 in Escherichia coli BW25113

Name: sfmA
Annotation: putative fimbrial-like protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00419: Fimbrial" amino acids 30 to 180 (151 residues), 98.7 bits, see alignment E=2.1e-32

Best Hits

Swiss-Prot: 100% identical to SFMA_ECO57: Uncharacterized fimbrial-like protein SfmA (sfmA) from Escherichia coli O157:H7

KEGG orthology group: K07352, type 1 fimbrial protein (inferred from 100% identity to eco:b0530)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0ABW5 at UniProt or InterPro

Protein Sequence (180 amino acids)

>b0530 putative fimbrial-like protein (VIMSS) (Escherichia coli BW25113)
MKLRFISSALAAALFAATGSYAAVVDGGTIHFEGELVNAACSVNTDSADQVVTLGQYRTD
IFNAVGNTSALIPFTIQLNDCDPVVAANAAVAFSGQADAINDNLLAIASSTNTTTATGVG
IEILDNTSAILKPDGNSFSTNQNLIPGTNVLHFSARYKGTGTSASAGQANADATFIMRYE